Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKFPVYIHSISGNSVFNNGFAVSISPFSVSKTTEGSGGSNTGLVFESNALSQTSSANQAQNVTYAIQELLSKLLA 4B9G Chain:A ((72-86)) ------------------------------------------------------NVNNPDQNMNYYIRK-------

General information: TITO was launched using: RESULT: Template: 4B9G.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 3 274 91.17 18.23 target 2D structure prediction score : 0.40 Monomeric hydrophicity matching model chain A : 0.49 3D Compatibility (PKB) : 91.17 2D Compatibility (Sec. Struct. Predict.) : 0.40 1D Compatibility (Hydrophobicity) : 0.49 QMean score : 0.805

(partial model without unconserved sides chains): PDB file : Tito_4B9G.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4B9G-query.scw PDB file : Tito_Scwrl_4B9G.pdb: