Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSSHYKYPLIFTAFLLIAFCLIFFSYHLIHHVRLEYPNWQGESKDQNWEAVFTKNEDAPNEYSGKLYWIGDTIEIDNTYLESLIVKKDDEVLLSSDTEIPMHDYAGGTFSDGSAKEKSVSFLERLDEHELEGHDITIEVKWKQGNHYSASQLTLNEKTLFDEKQQ 4HNV Chain:A ((847-880)) ---------------------------------------------------------------------------------------------SPNTEIYQHEMPGGQYSNLSQQAKSLGLGERFDE--------------------------------------

General information: TITO was launched using: RESULT: Template: 4HNV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 43 1848 42.98 54.35 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : 42.98 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.234

(partial model without unconserved sides chains): PDB file : Tito_4HNV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4HNV-query.scw PDB file : Tito_Scwrl_4HNV.pdb: