Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MATYNAIIYSGGYSQTLRDFAGWTGDLLTTIQDMKLHAQEFNSPYDAAMKIIGNMYQ---FSLDDLFSDVDAINLANKTSVGANAQPLNIAIRDYYSNNDC-MNR-FTQFVNNRFDGSLDKIFSEAEYYLNTNLDPVVVPIRLAFKRAFDVEDYSEEIGKITAQAFRDVIEKKMISE 3NZT Chain:A ((83-164)) -------------------------------------------PHDSIDKAIGELYQLSAFTLDNMHSDEIILN----TSMPLSANDNDIQEADFGSSNSGRMKRVYRKGLSARY-GKIMQIISGIHY-------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3NZT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 106 -2499 -23.58 -33.32 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -23.58 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.187

(partial model without unconserved sides chains): PDB file : Tito_3NZT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3NZT-query.scw PDB file : Tito_Scwrl_3NZT.pdb: