Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLIEERTYEERLYIYSDDIEARKHFVSELKPKGWMVDNCWVGIDLNQIKQFYRFKRELTDDYVFNR 4NX8 Chain:A ((81-141)) LKEVAKPVKKNKASLYVFDLRQESHGLINDIPVTWYADRDWANADLNHEEAVRRERRLLGD------

General information: TITO was launched using: RESULT: Template: 4NX8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 123 1369 11.13 22.44 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : 11.13 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.059

(partial model without unconserved sides chains): PDB file : Tito_4NX8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4NX8-query.scw PDB file : Tito_Scwrl_4NX8.pdb: