Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------------------------------------------------------------------ALSCGTVSGYVAPCIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR--------------------
1L6W Chain:A ((1-220))MELYLDTSDVVAVKALSRIFPLAGVTTNPSIIAAGKKPLDVVLPQLHEAMGGQGRLFAQVMATTAEGMVNDALKLRSIIADIVVKVPVTAEGLAAIKMLKAEGIPTLGTAVYGAAQGLLSALAGAEYVAPYVNRIDAQGG------SGIQTVTDLHQLLKMHAPQAKVLAA---SFKTPRQALDCLLAGCESITLPLDVAQQMISYPAVDAAVAKFEQDWQGAFGRTSI


General information:
TITO was launched using:
RESULT:

Template: 1L6W.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -37575 for 588 contacts (-63.9/contact) +
2D Compatibility (PS) -8680 + (NN) -2277 + (LL) 284
1D Compatibility (HY) -3200 + (ID) 750
Total energy: -52198.0 ( -88.77 by residue)
QMean score : 0.252

(partial model without unconserved sides chains):
PDB file : Tito_1L6W.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1L6W-query.scw
PDB file : Tito_Scwrl_1L6W.pdb: