Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNAGILGVGKYVPEKIVTNFDL-----EKIMDTSDEWIRTRTGIEERRIARDDEYTHDLAYEAAKVAIKNAGLTPDDIDLFIVATVTQEATFPSVANIIQDRLGAKN-AAGMDVEAACAGFTFGVVTAAQFIKTGAYKNIVVVGADKLSKITNWDDRTTAVLFGDGAGAVVMGPVSDDHGLLSFDLGSDGSGGKYLNLDENKK---------IYMNGREVFRFAVRQMGEASLRVLERAGLEKEDLDLLIPHQANIRIMEASRERLNLPEEKLMKTVHKYGNTSSSSIALALVDAVEEGRIKDNDNVLLVGFGGGLTWGALIIRWGK
4DFE Chain:A ((14-333))----VLGTGSYLPPNRVTNQDLAKRLA---IETSDEWIVARTGIHARYFAEPDVTTSDLAFIASQRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIRNHGAAFDVQAVCSGFAYAVATADSFIRSGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVIL-QASDEPGVLASALHADGSHSNILCTPGNVNGGVVSGSAFLHMDGQAVFKLAVNVLEKVAVEALEKANLSAEQIDWLIPHQANIRIMQSTCRKLGLPQERMIVTVGEHGNTSAASIPLALDVAVRDGRIKRGQNVLIEGVGGGFTWGASVIRY--


General information:
TITO was launched using:
RESULT:

Template: 4DFE.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -203154 for 2838 contacts (-71.6/contact) +
2D Compatibility (PS) -32409 + (NN) -11813 + (LL) 192
1D Compatibility (HY) -26400 + (ID) 7350
Total energy: -280934.0 ( -98.99 by residue)
QMean score : 0.627

(partial model without unconserved sides chains):
PDB file : Tito_4DFE.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4DFE-query.scw
PDB file : Tito_Scwrl_4DFE.pdb: