Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEKKSYTELMKSRNTQKTKEFDVTMTDIYIQMVLDESLYNRRLAMLTDQINKALDEKDKDAFLTLSKEYAALKQSE 4IWP Chain:A ((547-586)) -----------KDRNVEKLQVLLNCMTEIYYQFKKDKA--ERRLAYNEEQIHK------------------------

General information: TITO was launched using: RESULT: Template: 4IWP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 28 2265 80.89 56.63 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : 80.89 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.033

(partial model without unconserved sides chains): PDB file : Tito_4IWP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IWP-query.scw PDB file : Tito_Scwrl_4IWP.pdb: