Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVSKKNKIVAALLAFFFGGLGIHKFYLGRVGQGILYILFCWTGIPSIIAFIEFIIFLCGSEEGFDQKYNFYYFQQQSKA 2KI0 Chain:A ((8-19)) ------------------------------------------------------------------IWVGGTPEELKK-

General information: TITO was launched using: RESULT: Template: 2KI0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 9 1706 189.56 142.17 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.38 3D Compatibility (PKB) : 189.56 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.38 QMean score : -0.050

(partial model without unconserved sides chains): PDB file : Tito_2KI0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2KI0-query.scw PDB file : Tito_Scwrl_2KI0.pdb: