Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDFEKMKQWMEFAQQMYGGDFWKQVFDEDQKTPFMTNGQSPFPFAQQDQRGKGDASFPSMDIVDTVAEVQFLIYLPGYRKQD--VHILSYGDYLVV--KGQRFSYFNEQDFRQKEGKYGSFEKKIPLSDHLHGKMNAIFKDGILYITIQKDEGQAKTIVIDD 4RZK Chain:A ((85-162)) ---------------------------------------------------------PLADVIEKGDEIKVVAEVPGVNKEDIKVKVTNGGKKLVITAKSEDRQYYKEIDLPAE-------------VDEKAAKAN--FKNGVLEITLKK------------

General information: TITO was launched using: RESULT: Template: 4RZK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 309 -4037 -13.06 -54.55 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -13.06 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.462

(partial model without unconserved sides chains): PDB file : Tito_4RZK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4RZK-query.scw PDB file : Tito_Scwrl_4RZK.pdb: