Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSTIKVKSAHKDGQIKLEDLDVVCNKLCKRNNSVLFKLEKYLNKKLLSDPELTEIRDTILTVSGELSRLRDNLVTDGDSNEGLQ 1T2D Chain:A ((200-231)) -------------------------------------LQEFINNKLISDAELEAIFDRTVNTALEIVNL---------------

General information: TITO was launched using: RESULT: Template: 1T2D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 23 -7778 -338.15 -243.05 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -338.15 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.561

(partial model without unconserved sides chains): PDB file : Tito_1T2D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1T2D-query.scw PDB file : Tito_Scwrl_1T2D.pdb: