Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEKLFKEVKLEELENQKGSGLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR 4ICG Chain:B ((15-30)) -RAQARECTLETLEEML---------------------------------------

General information: TITO was launched using: RESULT: Template: 4ICG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 8 -1533 -191.56 -95.78 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : -191.56 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 1.088

(partial model without unconserved sides chains): PDB file : Tito_4ICG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ICG-query.scw PDB file : Tito_Scwrl_4ICG.pdb: