Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPNIKSAIKRTKTNNERRVHNATIKSAMRTAIKQVEASVANNEADKAKTALTEAAKRIDKAVKTGLVHKNTAARYKSRLAKKVNGLSA 1HR0 Chain:T ((11-91)) -----SALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQL--

General information: TITO was launched using: RESULT: Template: 1HR0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 225 -13186 -58.60 -162.78 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain T : 0.77 3D Compatibility (PKB) : -58.60 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.774

(partial model without unconserved sides chains): PDB file : Tito_1HR0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1HR0-query.scw PDB file : Tito_Scwrl_1HR0.pdb: