Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLKVAVFDEEHEKDLQTEINSFLKGISEEQLIDIKYTVSAACDPDGEQLYCFSALILYRK 4JWS Chain:A ((151-202)) ------FTEDYAEPFPIRIFMLLAGLPEEDIPHLKYLTDQMTR--GSMTFAEAKEALY--

General information: TITO was launched using: RESULT: Template: 4JWS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 83 -5875 -70.78 -117.50 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -70.78 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.326

(partial model without unconserved sides chains): PDB file : Tito_4JWS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4JWS-query.scw PDB file : Tito_Scwrl_4JWS.pdb: