Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTIFQRTIVVLIGTQLAASAVILFIFDLNSYNHFSGSFSWLHFLKELAGSFAFYLFSAGLFFLLIGLCAPSRKKKRISVHEKENSLK 4DKX Chain:A ((78-146)) ----------LIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGS--------DVIIMLVGNKTDLADKRQVSIEEGERKAK

General information: TITO was launched using: RESULT: Template: 4DKX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 215 -31880 -148.28 -462.02 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -148.28 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.409

(partial model without unconserved sides chains): PDB file : Tito_4DKX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4DKX-query.scw PDB file : Tito_Scwrl_4DKX.pdb: