Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAFDKQKLDVTNDVTGRFQNGRLSLYHDNEMIGQMTSMNEYELKSGYSFENEKFYKTADVVSGDDAKYVDCDYENGWC 1K1S Chain:A ((103-122)) -SIDEAYLDVTNKVEGNFENG---------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1K1S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 14 1604 114.54 80.18 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : 114.54 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.809

(partial model without unconserved sides chains): PDB file : Tito_1K1S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1K1S-query.scw PDB file : Tito_Scwrl_1K1S.pdb: