Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKSKLSILMIGFALSVLLAACGSNDAKEEKTDTGSKTEATASEGEELYQQSCVGCHGKDLEGVSGPNLQEVGGKYDEHKIESIIKNGRGNMPKGLVDDNEAAVIAKWLSEKK 1K3G Chain:A ((2-71)) ------------------------------------------DAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

General information: TITO was launched using: RESULT: Template: 1K3G.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 276 -27661 -100.22 -395.16 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -100.22 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.550

(partial model without unconserved sides chains): PDB file : Tito_1K3G.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1K3G-query.scw PDB file : Tito_Scwrl_1K3G.pdb: