Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEKEFQSKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL 3QP5 Chain:B ((198-250)) -----------LSQREYDIFHWMSRGKTNWEIATILDISERTVKFHVANVIRKLNANNRTHAIV----------

General information: TITO was launched using: RESULT: Template: 3QP5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 166 -25661 -154.58 -484.16 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain B : 0.76 3D Compatibility (PKB) : -154.58 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.752

(partial model without unconserved sides chains): PDB file : Tito_3QP5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3QP5-query.scw PDB file : Tito_Scwrl_3QP5.pdb: