Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAIVKATDQSFSAET--SEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL
2FCH Chain:D ((4-107))--IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRSIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL


General information:
TITO was launched using:
RESULT:

Template: 2FCH.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 431 6193 14.37 60.71
target 2D structure prediction score : 0.79
Monomeric hydrophicity matching model chain D : 0.86

3D Compatibility (PKB) : 14.37
2D Compatibility (Sec. Struct. Predict.) : 0.79
1D Compatibility (Hydrophobicity) : 0.86
QMean score : 0.649

(partial model without unconserved sides chains):
PDB file : Tito_2FCH.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2FCH-query.scw
PDB file : Tito_Scwrl_2FCH.pdb: