Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKTELIAKVAEKQGVSKKEGAPSVEKVFDTISEALKSGEKVSIPGFGTFEVRERAARKGRNPQTGEEIDIPATKAPAFKPAKALKDAVKAK 1B8Z Chain:A ((1-90)) MNKKELIDRVAKKAGAKKKDVKLILDTILETITEALAKGEKVQIVGFGSFEV-----------------------VPKFKPGKALKEKVK--

General information: TITO was launched using: RESULT: Template: 1B8Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 149 -12943 -86.86 -193.17 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.83 3D Compatibility (PKB) : -86.86 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.725

(partial model without unconserved sides chains): PDB file : Tito_1B8Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1B8Z-query.scw PDB file : Tito_Scwrl_1B8Z.pdb: