Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceKRLVVQRVTEASVTVDEEVVGQ----------IGQGLMVLVGITHDDTEDDAAYLADKVVNLRIFDDSEGKMNLSLVDIGGEILSVSQFTLYGDTKKGRRPNYMNAAKPDKALGLYEKWNDLLREK--GIKVETGTFGAMMDVQLTNSGPVTLIMDSK
3KOC Chain:C ((2-157))-RVVIQRVKGAILSVRKENIGENEKELEIISEIKNGLICFLGIHKNDTWEDALYIIRKCLNLRLWNNDNKTWDKNVKDLNYELLIVSQFTLFGNTKKGNKPDFHLAKEPNEALIFYNKIIDEFKKQYNDDKIKIGKFGNYMNIDVTNDGPVTIYIDT-


General information:
TITO was launched using:
RESULT:

Template: 3KOC.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 602 31593 52.48 219.39
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain C : 0.84

3D Compatibility (PKB) : 52.48
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.84
QMean score : 0.528

(partial model without unconserved sides chains):
PDB file : Tito_3KOC.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3KOC-query.scw
PDB file : Tito_Scwrl_3KOC.pdb: