Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------MRIWIKSLLVITACIFSLTLLNTKYTFYSPTVKLESAKVVYK---LNNEPFNVRLDVPLVNQMDAPTLFNGCEVTSLAMLLQFN-----GKRVTKNELANNLSTTPIEQNGLHGNPDKAFVGSISGDS---PGLGVNHAPIAKLAAKYVNEAHVH--D-ISGNSIQDIITVLSTGA-P-VWIITTTDYHAPKNWQTVQTK---------EGKKKITYSMHSVIITGFDKNNFYIN----DPYGHKNRAVKRSVLEEGWSAM-GKQAIY-LSRP-
1EF1 Chain:A ((1-294))TISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTK----GFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQ--DITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKP


General information:
TITO was launched using:
RESULT:

Template: 1EF1.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -37503 for 1471 contacts (-25.5/contact) +
2D Compatibility (PS) -24994 + (NN) -7460 + (LL) 252
1D Compatibility (HY) -9600 + (ID) 1700
Total energy: -81005.0 ( -55.07 by residue)
QMean score : 0.147

(partial model without unconserved sides chains):
PDB file : Tito_1EF1.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1EF1-query.scw
PDB file : Tito_Scwrl_1EF1.pdb: