Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ 2FAC Chain:B ((5-76)) -----ERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQ

General information: TITO was launched using: RESULT: Template: 2FAC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 252 -37567 -149.07 -521.76 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain B : 0.87 3D Compatibility (PKB) : -149.07 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.87 QMean score : 0.753

(partial model without unconserved sides chains): PDB file : Tito_2FAC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2FAC-query.scw PDB file : Tito_Scwrl_2FAC.pdb: