Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ 1L0I Chain:A ((2-77)) -STIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKMTTVQAAIDYINGHQ

General information: TITO was launched using: RESULT: Template: 1L0I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 270 -36990 -137.00 -486.71 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 0.87 3D Compatibility (PKB) : -137.00 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.87 QMean score : 0.774

(partial model without unconserved sides chains): PDB file : Tito_1L0I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1L0I-query.scw PDB file : Tito_Scwrl_1L0I.pdb: