Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSINIKAVTDDNRAAILDLHVSQNQLSYIESTKVCLEDAKECHYYKPVGLYYEGDLVGFAMYGLFPEYDEDNKNGRVWLDRFFIDERYQGKGLGKKMLKALIQHLAELYKCKRIYLSIFENNIHAIRLYQRFGFQFNGELDFNGEKVMVKEL 2I79 Chain:C ((92-148)) ---------------------------------------------------------------------------------IVIGKRYWNNGLGSLLLEEAIEWAQASGILRRLQLTVQTRNQAAVHLYQKHGFVIEG--------------

General information: TITO was launched using: RESULT: Template: 2I79.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 112 -30687 -273.99 -538.36 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain C : 0.59 3D Compatibility (PKB) : -273.99 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.771

(partial model without unconserved sides chains): PDB file : Tito_2I79.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2I79-query.scw PDB file : Tito_Scwrl_2I79.pdb: