Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKQLLQDSWWNQLKEEFEKPYYQELREMLKREYAEQTIY-PDSRDIFNALHYTSYDDVKVVILGQDPYHGPGQAQGLSFSVKPGVKQ-PPSLKNIFLELQQDIGCSIPNHGSLVSWAKQGVLLLNTVLTVRRGQANSHKGKGWERLTDRIIDVLSERERPVIFILWGRHAQMKKERIDTSKHFIIESTHPSPFSARNGFFGSRPFSRANAYLEKMGEAPIDWCIKDL
4WPK Chain:A ((17-235))LSELVERGWAAALEPVADQ--VAHMGQFLRAEIAAGRRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDEYTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDW-----


General information:
TITO was launched using:
RESULT:

Template: 4WPK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1120 -6999 -6.25 -32.25
target 2D structure prediction score : 0.72
Monomeric hydrophicity matching model chain A : 0.83

3D Compatibility (PKB) : -6.25
2D Compatibility (Sec. Struct. Predict.) : 0.72
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.576

(partial model without unconserved sides chains):
PDB file : Tito_4WPK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4WPK-query.scw
PDB file : Tito_Scwrl_4WPK.pdb: