Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKTELINAVAEASELSKKDATKAVDSVFDTILDALKNGDKIQLIGFGNFEVRERSARKGRNPQTGEEIEIPASKVPAFKPGKALKDAVAGK 1HUU Chain:C ((1-90)) MNKTELINAVAETSGLSKKDATKAVDAVFDSITEALRKGDKVQLIGFGNFEVRE-------------------RKVPAFKPGKALKDAVK--

General information: TITO was launched using: RESULT: Template: 1HUU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 166 -13308 -80.17 -187.43 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain C : 0.91 3D Compatibility (PKB) : -80.17 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.91 QMean score : 0.579

(partial model without unconserved sides chains): PDB file : Tito_1HUU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1HUU-query.scw PDB file : Tito_Scwrl_1HUU.pdb: