Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
1KDN Chain:B ((9-138))--ERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPL-ASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWF---


General information:
TITO was launched using:
RESULT:

Template: 1KDN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -81381 for 1015 contacts (-80.2/contact) +
2D Compatibility (PS) -14048 + (NN) -5206 + (LL) 212
1D Compatibility (HY) -12400 + (ID) 3550
Total energy: -116373.0 ( -114.65 by residue)
QMean score : 0.542

(partial model without unconserved sides chains):
PDB file : Tito_1KDN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1KDN-query.scw
PDB file : Tito_Scwrl_1KDN.pdb: