Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMALLEIIHYPSKILRTISKEVVSFDSKLHQQLDDMHETMIASEGIGLAAIQVGLPLRMLIINLPQEDGVQHKEDCLEIINPKWIETKGSIMYREGCLSVPGFYEEVERFEKVKIEYQNRFAEVKILEASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKELQKKQKHK
1BS4 Chain:B ((1-163))-SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSE-----NRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA


General information:
TITO was launched using:
RESULT:

Template: 1BS4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -89096 for 1269 contacts (-70.2/contact) +
2D Compatibility (PS) -17341 + (NN) -3551 + (LL) 376
1D Compatibility (HY) -13600 + (ID) 3350
Total energy: -126562.0 ( -99.73 by residue)
QMean score : 0.460

(partial model without unconserved sides chains):
PDB file : Tito_1BS4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1BS4-query.scw
PDB file : Tito_Scwrl_1BS4.pdb: