Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSVIQVKGNVTYPITIDPSVWIFDDRKFSFDRKGDSQDTYLQSAGDESDLDPERVIREGRIAPPTLKTEKQYEKQKLMNGSFAMRLGTVLKNAEPNSSATQCVFVTSSG---KAAVSLETA-LNSIVHFSEAGKPIQ--EGGPVHIYFEDPVHHKQPITDVKEIEII 2XTS Chain:A ((149-233)) ---------------------------------------------------------------------------------VGVPLSVLLAEAGVKPEGKWLYAEGADASSNGRSFPMEKVMDDVMLAFFANGEALRKEHGYPARLVVPGWEGNMW-VKWVRRLGIY

General information: TITO was launched using: RESULT: Template: 2XTS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 315 -57971 -184.03 -733.80 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : -184.03 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.605

(partial model without unconserved sides chains): PDB file : Tito_2XTS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2XTS-query.scw PDB file : Tito_Scwrl_2XTS.pdb: