Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------------TEVKLSGGEADVTCDAVQLSSCATPMLTGVPPSTECCGKLKEQQPCFCTYIKDPRYSQYVGSANAKKTLATCGVPYPTC----
1SJW Chain:A ((2-143))SRQTEIVRRMVSAFNTGRTDDVDEYIHPDYLNPATLEHGIHTGPKAFAQLVGWVRATFSEEARLEEVRIEERGPWVKAYLVLYGRHVGRLVGMPPT----DRRFSGEQVHLMRIVDGKIRDHRDWPDFQGTLRQLGDPWPDDEGWR


General information:
TITO was launched using:
RESULT:

Template: 1SJW.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) 3633 for 429 contacts (8.5/contact) +
2D Compatibility (PS) -8235 + (NN) -2155 + (LL) 268
1D Compatibility (HY) 0 + (ID) 650
Total energy: -7139.0 ( -16.64 by residue)
QMean score : 0.272

(partial model without unconserved sides chains):
PDB file : Tito_1SJW.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1SJW-query.scw
PDB file : Tito_Scwrl_1SJW.pdb: