Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMQNGKVKWFNNEKGYGFIESDGGEDIFVHFTAIQGDGYKSLEEGQAVTFEVVEGNRGAQAANVEKA
1HZB Chain:A ((1-65))MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVK-


General information:
TITO was launched using:
RESULT:

Template: 1HZB.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -24760 for 431 contacts (-57.4/contact) +
2D Compatibility (PS) -6930 + (NN) -2472 + (LL) 144
1D Compatibility (HY) -7600 + (ID) 2550
Total energy: -44168.0 ( -102.48 by residue)
QMean score : 0.671

(partial model without unconserved sides chains):
PDB file : Tito_1HZB.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1HZB-query.scw
PDB file : Tito_Scwrl_1HZB.pdb: