Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFLFTNGKVLWGAVIAAFILSIVFYPFLPTQMPIHYDVANSPDLTVNKLAGTVMLPVLMVVFAWARKINWQFVFAVYILLICHIVVLCLAL 3C5T Chain:B ((16-23)) -EWLKNGGP----------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3C5T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 3 -291 -96.83 -36.31 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain B : 0.32 3D Compatibility (PKB) : -96.83 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.32 QMean score : 1.004

(partial model without unconserved sides chains): PDB file : Tito_3C5T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3C5T-query.scw PDB file : Tito_Scwrl_3C5T.pdb: