Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MELAGFMLRACALLLDVIIAAAVILAAGFTFGDGSAGVIIVAILMLIVYPLLMPLTNWKGTLGKKIIGLQIVRDETYKKISFPQAIVRYLIAWVHVFSRLIYLTAAFTKKKQTVHDMAAKTIVLKAE 3I2M Chain:X ((217-253)) -------------------------------------------------PETKPVSGWDGLKGKKSVDVGVVHTDALSRVSLESLI-----------------------------------------

General information: TITO was launched using: RESULT: Template: 3I2M.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 36 -4699 -130.51 -126.99 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain X : 0.46 3D Compatibility (PKB) : -130.51 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.473

(partial model without unconserved sides chains): PDB file : Tito_3I2M.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3I2M-query.scw PDB file : Tito_Scwrl_3I2M.pdb: