Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSEALTFESKYALLYLGGGLLAMIYGLITFFMAFPAFTSRGNVIFTIKTGPSGEIFLRKRSVLFSEVKRLYMGRHQYSLKGIFFEDIIIEKTDGKIVRIPTWNIITNPLFFEAVERYILPHLNEEAQNNWISQFTEVQRKAYLKEFENHPKL 4TYZ Chain:A ((53-109)) ---------------------------------------------------------AHFSIEYDEIKDIIKSKSV----KMFENAIEVKTHLNDTIFLTNFL-----QRDQAYSA---------LMSQWLK--------------------

General information: TITO was launched using: RESULT: Template: 4TYZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 158 -19200 -121.52 -336.83 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain A : 0.50 3D Compatibility (PKB) : -121.52 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.476

(partial model without unconserved sides chains): PDB file : Tito_4TYZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4TYZ-query.scw PDB file : Tito_Scwrl_4TYZ.pdb: