Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDSYKVIELANKYSAAAEEVRSSKMLLESRLSALGDAWQGKARDSFDQDFEETKAAYDQFEQELLETSQELKAAAVKIEERKAEIARMEELERKAREERHKLGR 4IYI Chain:A ((14-83)) --------IAGNFKNAAGEAQSQINRLEGDINSLEGQWAGATQAKFRGEFIQSKQAMQQYIPILEGISTDLKRIADKF--------------------------

General information: TITO was launched using: RESULT: Template: 4IYI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 59 -7898 -133.86 -112.83 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : -133.86 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.775

(partial model without unconserved sides chains): PDB file : Tito_4IYI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IYI-query.scw PDB file : Tito_Scwrl_4IYI.pdb: