Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKNGFAYKNGKLVNIFCGKEELYNELKAFLVKTFSINVKEVSRPSIYRRTKSKQLE 2LD7 Chain:B ((505-524)) ------------VSPFLGKFPELFNWFKNFLG-------------------------

General information: TITO was launched using: RESULT: Template: 2LD7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 24 -7989 -332.88 -399.45 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain B : 0.63 3D Compatibility (PKB) : -332.88 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 1.093

(partial model without unconserved sides chains): PDB file : Tito_2LD7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LD7-query.scw PDB file : Tito_Scwrl_2LD7.pdb: