Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKHKKIPLRKCVVTGEMKPKKELIRVVRSKEGEISVDPTGKKNGRGAYLTLDK-ECILAAKKKNTLQNQFQSQIDDQIFDELLELAEKVKK 4ADN Chain:A ((163-215)) --------KGFCTICNKES---NVSLFMKKSKTN----SDGQYVKKGDYICRDSIHCNKQLTDINQFY------------------------

General information: TITO was launched using: RESULT: Template: 4ADN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 153 -11881 -77.65 -228.47 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -77.65 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.581

(partial model without unconserved sides chains): PDB file : Tito_4ADN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ADN-query.scw PDB file : Tito_Scwrl_4ADN.pdb: