Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRLSELSGKEIVDIKRAERLGVLGQTDLEINEQDGQITALLIPTVKWFGLRKQGHDIRVPWHHIQKIG--SDMIILDVPEEMPPRQE 1EYS Chain:H ((149-212)) ---PDPRGMTVVGL-DGEVAGTV--SDVWVDRSEPQIRYLEVEVAA------NKKKVLLPIG-FSRFDKKARKVKVD----------

General information: TITO was launched using: RESULT: Template: 1EYS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 230 -30308 -131.77 -488.83 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain H : 0.71 3D Compatibility (PKB) : -131.77 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.475

(partial model without unconserved sides chains): PDB file : Tito_1EYS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1EYS-query.scw PDB file : Tito_Scwrl_1EYS.pdb: