Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVKRKANHVINGMNDAKSQGKGAGYIENDQLVLTEAERQNNKKRKTNQ 4ZBJ Chain:D ((8-14)) --------------------MGYGYDE---------------------

General information: TITO was launched using: RESULT: Template: 4ZBJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 1 268 268.00 38.29 target 2D structure prediction score : 1.00 Monomeric hydrophicity matching model chain D : 0.70 3D Compatibility (PKB) : 268.00 2D Compatibility (Sec. Struct. Predict.) : 1.00 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 1.658

(partial model without unconserved sides chains): PDB file : Tito_4ZBJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ZBJ-query.scw PDB file : Tito_Scwrl_4ZBJ.pdb: