Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVKKALIVILILLPFVQLALLPLVNRIEPIMFGLPFFHFWLLLWIIVTPLCSFGIYQMQKKDGGLE 4QNC Chain:A ((58-81)) ----------------------------------LPIILANVVTLFFVTIILYYKLTE--------

General information: TITO was launched using: RESULT: Template: 4QNC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -116 -58.00 -4.83 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain A : 0.46 3D Compatibility (PKB) : -58.00 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.149

(partial model without unconserved sides chains): PDB file : Tito_4QNC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4QNC-query.scw PDB file : Tito_Scwrl_4QNC.pdb: