Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MCNRNVITIPYEEDMSKYSILHQVGGRIEYFQKEYSQYPMFAFDSEEDYNEYKCLIMQLKKNKKVSSFSF 2A6Q Chain:A ((32-61)) -----------------------DHAPIL-ITRQ--NGEACVLMSLEEYNSLEETA--------------

General information: TITO was launched using: RESULT: Template: 2A6Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 43 -4417 -102.72 -147.23 target 2D structure prediction score : 0.37 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -102.72 2D Compatibility (Sec. Struct. Predict.) : 0.37 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.246

(partial model without unconserved sides chains): PDB file : Tito_2A6Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2A6Q-query.scw PDB file : Tito_Scwrl_2A6Q.pdb: