Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEKFVEKMLGQALRQYGRNVAIDP--L-SPYEKQSLKAALQERRNEEPDEDLHAHIEDIIYDYVTNQGLFS 2A7O Chain:A ((24-63)) --KEMSQFIVQCLNPYR-KPDCKVGRITTTEDFKHLARKLTHG----------------------------

General information: TITO was launched using: RESULT: Template: 2A7O.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 80 -5070 -63.37 -137.01 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -63.37 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.505

(partial model without unconserved sides chains): PDB file : Tito_2A7O.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2A7O-query.scw PDB file : Tito_Scwrl_2A7O.pdb: