Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFTAKLIKGKTYNVMGITFRAGVSQTVPKKLYEYLNENPYFILTQELNNQKDDPINYTESELKGMNKAEHESIISNLGRNPSDFKNADERIAYILKQIDNKGE 4WIM Chain:A ((195-287)) ------IYNKEYNIYGVQYHPEVYESLDGELMFY-----NFAYNICKCKKQFDPIRYHELELKNIEKYKHDHYV-----------------------------

General information: TITO was launched using: RESULT: Template: 4WIM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 69 -2660 -38.54 -42.21 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -38.54 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.310

(partial model without unconserved sides chains): PDB file : Tito_4WIM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WIM-query.scw PDB file : Tito_Scwrl_4WIM.pdb: