Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVENPMVINNWHDKLTETDVQIDFYGDEVTPVDDYVIDGGEIILR-ENLERYLREQLGFEFKNAQ 1DFU Chain:P ((35-80)) --EAPLAIELDHDKVMNMQAKAEFYSEVLT----IVVDGKEIKVKAQDVQRH-------------

General information: TITO was launched using: RESULT: Template: 1DFU.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 70 -9491 -135.58 -210.90 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain P : 0.73 3D Compatibility (PKB) : -135.58 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.140

(partial model without unconserved sides chains): PDB file : Tito_1DFU.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1DFU-query.scw PDB file : Tito_Scwrl_1DFU.pdb: