Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MALNTRESARDITALDIPDTSASNTFEIGFVTENVEAVIKRMREQGVSIIGEP---KVKPWGQTVAYIADPDGHYIEICSPME 4OPN Chain:A ((127-177)) --------------------------HIGIAVPDVYSACKRFEELGVKFVKKPDDGKMK----GLAFIQDPDGYWIEILNP--

General information: TITO was launched using: RESULT: Template: 4OPN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 152 1235 8.13 25.73 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : 8.13 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.855

(partial model without unconserved sides chains): PDB file : Tito_4OPN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OPN-query.scw PDB file : Tito_Scwrl_4OPN.pdb: