Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVYQTKRDVPVTLMIVFLILLIQADAIVPFVLGNMRVSGWIIFILLTLLNGLIIWSFIDLKYVLKEHHLIIKAGLIKHQIPYENIDKVVQKKKLWSGFRLIGSRHAITIYYQGGWGHA-VISPQKSEEFIHKLKEKNSNIIIFTKSK 4TYZ Chain:A ((53-106)) ---------------------------------------------------------------------------AHFSIEYDEIKDIIKSKSVK------MFENAIEVKTHL-NDTIFLTNFLQRDQAYSALMSQ-----------

General information: TITO was launched using: RESULT: Template: 4TYZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 144 -3667 -25.47 -69.19 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.46 3D Compatibility (PKB) : -25.47 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.468

(partial model without unconserved sides chains): PDB file : Tito_4TYZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4TYZ-query.scw PDB file : Tito_Scwrl_4TYZ.pdb: