Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMGNLSFLATSDGASLAYRLDGAAEKPLLALSNSIGTTLHMWDAQLPALTRHFRVLRYDARGHGASSVPPGPYTLARLGEDVLELLDALEVRRAHFL-GLSLGGIVGQWLALHAPQRIERLVLANTSAWL-GPAAQWDERIAAVLQAEDMSETAAGFLGNWFPPALLE----RAEP-VVERFRAMLMATNRHGL-AGSFAAVRDTDLRAQLARIERPTLVIAGAYDTVTAASHGELIAASIAGARLVTLP-AVHLSNVEFPQAFEGAVLSFLGAA
4UHD Chain:A ((6-268))--KITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRT--MWKAQREELCDEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKEN----RRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGHLPPMEQPERVTQAIREWLRKV


General information:
TITO was launched using:
RESULT:

Template: 4UHD.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -157339 for 2274 contacts (-69.2/contact) +
2D Compatibility (PS) -26597 + (NN) -3650 + (LL) 808
1D Compatibility (HY) -16400 + (ID) 3850
Total energy: -207028.0 ( -91.04 by residue)
QMean score : 0.420

(partial model without unconserved sides chains):
PDB file : Tito_4UHD.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4UHD-query.scw
PDB file : Tito_Scwrl_4UHD.pdb: