Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--M-RLDKFLKVSRLIKRRTLAKEVADQGRISINGNQAK-ASSDVKPGDELTVRFGQK-------LV-TVQVNELKDTTKKEEAANMYTILKEEKLGE-----------------------------------------------------------------------------------------------------------------------------------------
1KSK Chain:A ((1-234))GSHMRLDKFIAQQLGVSRAIAGREIR-GNRVTVDGEIVRNAAFKLLPEHDVAYDGNPLAQQHGPRYFMLNKPQGYVCSTDDPDHPTVLYFLDEPVAWKLHAAGRLDIDTTGLVLMTDDGQWSHRITSPRHHCEKTYLVTLESPVADDTAEQFAKGVQLHNEKDLTKPAVLEVITPTQVRLTISEGRYHQVKRMFAAVGNHVVELHRERIGGITLDADLAPGEYRPLTEEEIASVV


General information:
TITO was launched using:
RESULT:

Template: 1KSK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -1337 for 471 contacts (-2.8/contact) +
2D Compatibility (PS) -8686 + (NN) -706 + (LL) -76
1D Compatibility (HY) -3600 + (ID) 700
Total energy: -15105.0 ( -32.07 by residue)
QMean score : 0.438

(partial model without unconserved sides chains):
PDB file : Tito_1KSK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1KSK-query.scw
PDB file : Tito_Scwrl_1KSK.pdb: