Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAIVKATDQSFSAET--SEGVVLADFWAPWCGPCKMIAPVLEELDQEMGDKLKIVKIDVDENQETAGKYGVMSIPTLLVLKDGEVVETSVGFKPKEALQELVNKHL
2BTO Chain:T ((4-106))--IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDAN-


General information:
TITO was launched using:
RESULT:

Template: 2BTO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 418 4288 10.26 42.46
target 2D structure prediction score : 0.82
Monomeric hydrophicity matching model chain T : 0.85

3D Compatibility (PKB) : 10.26
2D Compatibility (Sec. Struct. Predict.) : 0.82
1D Compatibility (Hydrophobicity) : 0.85
QMean score : 0.653

(partial model without unconserved sides chains):
PDB file : Tito_2BTO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2BTO-query.scw
PDB file : Tito_Scwrl_2BTO.pdb: