Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MMCKLEWDDEINFGKISFLSHSHIPDRKTGLELAEKYGIDGVMIGSGIFHNPFAF----EKEPREHTSKELLDLLRLHLSLFNKYEKDEIRQFKSLRRFFKIYVRGIRALANFDIN-----------------------
3B0P Chain:A ((2-318))LDPRLSVAPMVDRTDRHFRFLVRQVSLGVRLYTEMTVDQAVLRGNRERLLAFRPEEHPIALQLAGSDPKSLAEAARIGEAFGYDEINLNLGCPSEKAQEGGYGACLLLDLARVREILKAMGEAVRVPVTVKMRLGLEGKETYRGLAQSVEAMAEAGVKVFVVHARSALIPPLRHDWVHRLKGD----FPQLTFVTNGGIRSLEEALFHLKR--VDGVMLGRAVYEDPFVLEEADRRVFGLPRRPSRLEVARRMRAYLEEEVLKGTPPWAVLRHMLNLF-RGRPKGRLWRRLLSEGRSLQALDRALRLMEEEVGE


General information:
TITO was launched using:
RESULT:

Template: 3B0P.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -30420 for 590 contacts (-51.6/contact) +
2D Compatibility (PS) -11348 + (NN) -8104 + (LL) 264
1D Compatibility (HY) -6400 + (ID) 950
Total energy: -56958.0 ( -96.54 by residue)
QMean score : 0.422

(partial model without unconserved sides chains):
PDB file : Tito_3B0P.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3B0P-query.scw
PDB file : Tito_Scwrl_3B0P.pdb: